PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_51173g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 370aa    MW: 40598.6 Da    PI: 7.7944
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_51173g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.52.4e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd  l+++++++G+g +W + ++++g++R++k+c++rw++yl
    MA_51173g0010 14 KGPWSPEEDSELKEYIAKYGTGgNWIALPQKVGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding36.51.1e-1169111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
    MA_51173g0010  69 GGFSEEEDNIICSLYLSIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.29966IPR017930Myb domain
SuperFamilySSF466891.07E-2611109IPR009057Homeodomain-like
SMARTSM007172.8E-131364IPR001005SANT/Myb domain
PfamPF002491.1E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-241569IPR009057Homeodomain-like
CDDcd001673.12E-101662No hitNo description
PROSITE profilePS5129415.68167117IPR017930Myb domain
SMARTSM007174.0E-1067115IPR001005SANT/Myb domain
PfamPF002492.1E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2270117IPR009057Homeodomain-like
CDDcd001679.59E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0035987Biological Processendodermal cell differentiation
GO:0045597Biological Processpositive regulation of cell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000021Biological Processregulation of ion homeostasis
GO:2000067Biological Processregulation of root morphogenesis
GO:0048226Cellular ComponentCasparian strip
GO:0000975Molecular Functionregulatory region DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDSELKEYIA KYGTGGNWIA LPQKVGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDNIIC SLYLSIGSRW SIIAAQLPGR TDNDIKNYWN TKLKNKLLGK  120
GKDRQTRRLA AAKQKSKDMQ SYATSGANPN PSIYGPQHQP GGIXXNPSIY GPQHQPGGID  180
KHTNINMNGP YCNFGPQINS QLFEQNCGAT ITESSSSSGP ATFQLNGQQV QLDQELADHN  240
SSLRKLLQRL EGTVVDHHNS SNMTMINTSS PIQASDCINT SEIMHSIAYN QYNSDAVSHI  300
SYETAASSVL MFGGHMENHT KLENPSAAFT QNDNLLFFPS STSPEGGNYE SAWMNTFSAE  360
NNLGASGFSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-26141177108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLD5ABB61e-160D5ABB6_PICSI; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.12e-75myb domain protein 36